Lineage for d4z42d_ (4z42 D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928867Fold d.8: Urease, gamma-subunit [54110] (1 superfamily)
    alpha(3)-beta(2); antiparallel hairpin
  4. 2928868Superfamily d.8.1: Urease, gamma-subunit [54111] (2 families) (S)
  5. 2928956Family d.8.1.0: automated matches [193589] (1 protein)
    not a true family
  6. 2928957Protein automated matches [193590] (3 species)
    not a true protein
  7. 2928969Species Yersinia enterocolitica [TaxId:913028] [315538] (1 PDB entry)
  8. 2928971Domain d4z42d_: 4z42 D: [315550]
    Other proteins in same PDB: d4z42b_, d4z42e_, d4z42h_, d4z42k_
    automated match to d4fura_
    complexed with ni

Details for d4z42d_

PDB Entry: 4z42 (more details), 3.01 Å

PDB Description: crystal structure of urease from yersinia enterocolitica
PDB Compounds: (D:) Urease subunit gamma

SCOPe Domain Sequences for d4z42d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4z42d_ d.8.1.0 (D:) automated matches {Yersinia enterocolitica [TaxId: 913028]}
mqltpreveklmiytlsdvafkrkarglklnypeavsiitvtamegardgksvedvmkea
skvltkddvmdgvadlipnvqveaiftdgsrlvtvhdpi

SCOPe Domain Coordinates for d4z42d_:

Click to download the PDB-style file with coordinates for d4z42d_.
(The format of our PDB-style files is described here.)

Timeline for d4z42d_: