Lineage for d1ep1b2 (1ep1 B:103-262)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 68846Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
  4. 68847Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families) (S)
  5. 68909Family c.25.1.3: Dihydroorotate dehydrogenase B, PyrK subunit [52362] (1 protein)
  6. 68910Protein Dihydroorotate dehydrogenase B, PyrK subunit [52363] (1 species)
  7. 68911Species Lactococcus lactis, isozyme B [TaxId:1358] [52364] (3 PDB entries)
  8. 68913Domain d1ep1b2: 1ep1 B:103-262 [31555]
    Other proteins in same PDB: d1ep1a_, d1ep1b1

Details for d1ep1b2

PDB Entry: 1ep1 (more details), 2.2 Å

PDB Description: crystal structure of lactococcus lactis dihydroorotate dehydrogenase b

SCOP Domain Sequences for d1ep1b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ep1b2 c.25.1.3 (B:103-262) Dihydroorotate dehydrogenase B, PyrK subunit {Lactococcus lactis, isozyme B}
pvaevtstdkiliigggigvpplyelakqlektgcqmtillgfasenvkilenefsnlkn
vtlkiatddgsygtkghvgmlmneidfevdalytcgapamlkavakkydqlerlyismes
rmacgigacyacvehdkedeshalkvcedgpvflgkqlsl

SCOP Domain Coordinates for d1ep1b2:

Click to download the PDB-style file with coordinates for d1ep1b2.
(The format of our PDB-style files is described here.)

Timeline for d1ep1b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ep1b1
View in 3D
Domains from other chains:
(mouse over for more information)
d1ep1a_