Lineage for d4yzra_ (4yzr A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2331668Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2331669Protein automated matches [190847] (72 species)
    not a true protein
  7. 2331725Species Bacillus subtilis [TaxId:224308] [315543] (1 PDB entry)
  8. 2331726Domain d4yzra_: 4yzr A: [315544]
    automated match to d3weca_
    complexed with hem, his

Details for d4yzra_

PDB Entry: 4yzr (more details), 1.35 Å

PDB Description: bacillus subtilis 168 bacillaene polyketide synthase (pks) cytochrome p450 pkss
PDB Compounds: (A:) Polyketide biosynthesis cytochrome P450 PksS

SCOPe Domain Sequences for d4yzra_:

Sequence, based on SEQRES records: (download)

>d4yzra_ a.104.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 224308]}
mfhphgkefhhnpfsvlgrfreeepihrfelkrfgatypawlitryddcmaflkdnritr
dvknvmnqeqikmlnvsedidfvsdhmlakdtpdhtrlrslvhqaftprtienlrgsieq
iaeqlldemekenkadimksfasplpfiviselmgipkedrsqfqiwtnamvdtsegnre
ltnqalrefkdyiaklihdrrikpkddlisklvhaeengsklsekelysmlfllvvagle
ttvnllgsgtlallqhkkeceklkqqpemiataveellrytspvvmmanrwaiedftykg
hsikrgdmifigigsanrdpnffenpeilninrspnrhisfgfgihfclgaplarleghi
afkallkrfpdielavapddiqwrknvflrgleslpvslsk

Sequence, based on observed residues (ATOM records): (download)

>d4yzra_ a.104.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 224308]}
mfhphgkefhhnpfsvlgrfreeepihrfelkatypawlitryddcmaflkdnritrdvk
nvmnqdidfvsdhmlakdtpdhtrlrslvhqaftprtienlrgsieqiaeqlldemeken
kadimksfasplpfiviselmgipkedrsqfqiwtnamvdtsegnreltnqalrefkdyi
aklihdrrikpkddlisklvhaeengsklsekelysmlfllvvaglettvnllgsgtlal
lqhkkeceklkqqpemiataveellrytspvvmmanrwaiedftykghsikrgdmifigi
gsanrdpnffenpeilninrspnrhisfgfgihfclgaplarleghiafkallkrfpdie
lavapddiqwrknvflrgleslpvslsk

SCOPe Domain Coordinates for d4yzra_:

Click to download the PDB-style file with coordinates for d4yzra_.
(The format of our PDB-style files is described here.)

Timeline for d4yzra_: