Lineage for d4z42h_ (4z42 H:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2427208Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2427322Superfamily b.85.3: Urease, beta-subunit [51278] (2 families) (S)
  5. 2427410Family b.85.3.0: automated matches [315534] (1 protein)
    not a true family
  6. 2427411Protein automated matches [315535] (1 species)
    not a true protein
  7. 2427412Species Yersinia enterocolitica [TaxId:913028] [315536] (1 PDB entry)
  8. 2427415Domain d4z42h_: 4z42 H: [315537]
    Other proteins in same PDB: d4z42a_, d4z42d_, d4z42g_, d4z42j_
    automated match to d4ubpb_
    complexed with ni

Details for d4z42h_

PDB Entry: 4z42 (more details), 3.01 Å

PDB Description: crystal structure of urease from yersinia enterocolitica
PDB Compounds: (H:) urease subunit beta

SCOPe Domain Sequences for d4z42h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4z42h_ b.85.3.0 (H:) automated matches {Yersinia enterocolitica [TaxId: 913028]}
ntplggciladtpitfnenkpvtkvkvrntgdrpiqvgshfhffevnralefdraaaygk
rlnissttairfepgdetevplipfggkqtlygfnnlvdgwtgegvvpnserpd

SCOPe Domain Coordinates for d4z42h_:

Click to download the PDB-style file with coordinates for d4z42h_.
(The format of our PDB-style files is described here.)

Timeline for d4z42h_: