SCOP 1.59: Domain d2pia_2: 2pia 104-223

Lineage for d2pia_2 (2pia 104-223)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)

4. Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families)

5. Family c.25.1.2: Phthalate dioxygenase reductase [52359] (1 protein)

6. Protein Phthalate dioxygenase reductase [52360] (1 species)

7. Species Pseudomonas cepacia, db01 [TaxId:292] [52361] (1 PDB entry)

8. Domain d2pia_2: 2pia 104-223 [31553]
   Other proteins in same PDB: d2pia_1, d2pia_3

Details for d2pia_2

PDB Entry: 2pia, 2 Å

PDB Description: phthalate dioxygenase reductase: a modular structure for electron transfer from pyridine nucleotides to [2fe-2s]

SCOP Domain Sequences for d2pia_2:

Sequence; same for both SEQRES and ATOM records:

>d2pia_2 c.25.1.2 (104-223) Phthalate dioxygenase reductase {Pseudomonas cepacia, db01}
efpldkraksfilvaggigitpmlsmarqlraeglrsfrlyyltrdpegtaffdeltsde
wrsdvkihhdhgdptkafdfwsvfekskpaqhvyccgpqalmdtvrdmtghwpsgtvhfe

Timeline for d2pia_2:

• d2pia_2 first appeared (with stable ids) in SCOP 1.55
  
• d2pia_2 appears in SCOP 1.57
  
• d2pia_2 appears in SCOP 1.61
  
• d2pia_2 appears in the current release, SCOPe 2.08, called d2piaa2