Lineage for d2pia_2 (2pia 104-223)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22422Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
  4. 22423Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families) (S)
  5. 22476Family c.25.1.2: Phthalate dioxygenase reductase [52359] (1 protein)
  6. 22477Protein Phthalate dioxygenase reductase [52360] (1 species)
  7. 22478Species Pseudomonas cepacia, db01 [TaxId:292] [52361] (1 PDB entry)
  8. 22479Domain d2pia_2: 2pia 104-223 [31553]
    Other proteins in same PDB: d2pia_1, d2pia_3

Details for d2pia_2

PDB Entry: 2pia (more details), 2 Å

PDB Description: phthalate dioxygenase reductase: a modular structure for electron transfer from pyridine nucleotides to [2fe-2s]

SCOP Domain Sequences for d2pia_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pia_2 c.25.1.2 (104-223) Phthalate dioxygenase reductase {Pseudomonas cepacia, db01}
efpldkraksfilvaggigitpmlsmarqlraeglrsfrlyyltrdpegtaffdeltsde
wrsdvkihhdhgdptkafdfwsvfekskpaqhvyccgpqalmdtvrdmtghwpsgtvhfe

SCOP Domain Coordinates for d2pia_2:

Click to download the PDB-style file with coordinates for d2pia_2.
(The format of our PDB-style files is described here.)

Timeline for d2pia_2: