![]() | Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
![]() | Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily) |
![]() | Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families) ![]() |
![]() | Family c.25.1.2: Phthalate dioxygenase reductase [52359] (1 protein) |
![]() | Protein Phthalate dioxygenase reductase [52360] (1 species) |
![]() | Species Pseudomonas cepacia, db01 [TaxId:292] [52361] (1 PDB entry) |
![]() | Domain d2pia_2: 2pia 104-223 [31553] Other proteins in same PDB: d2pia_1, d2pia_3 |
PDB Entry: 2pia (more details), 2 Å
SCOP Domain Sequences for d2pia_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pia_2 c.25.1.2 (104-223) Phthalate dioxygenase reductase {Pseudomonas cepacia, db01} efpldkraksfilvaggigitpmlsmarqlraeglrsfrlyyltrdpegtaffdeltsde wrsdvkihhdhgdptkafdfwsvfekskpaqhvyccgpqalmdtvrdmtghwpsgtvhfe
Timeline for d2pia_2: