Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Pseudomonas fluorescens [TaxId:294] [315515] (1 PDB entry) |
Domain d4yxfb_: 4yxf B: [315528] automated match to d3gdfa_ |
PDB Entry: 4yxf (more details), 2.7 Å
SCOPe Domain Sequences for d4yxfb_:
Sequence, based on SEQRES records: (download)
>d4yxfb_ c.2.1.0 (B:) automated matches {Pseudomonas fluorescens [TaxId: 294]} kgtiivsggsqglglttvrcfleagynvatfsrrespavtelseradfhwqaldctdysa ltafvqqvekrfggldglvnnaatgvegilstmrvadidsaldinlkgqlyltklvtakl lkrgagsvvnvssinalrghsgltvysatkaamdgltrslakelgprgirvnsvspgyfs sdmvkdlspqtlsrierrtplgrlgtqqevadlilylvdrgtfvtgqniavdggft
>d4yxfb_ c.2.1.0 (B:) automated matches {Pseudomonas fluorescens [TaxId: 294]} kgtiivsggsqglglttvrcfleagynvatfsrrespavtelseradfhwqaldctdysa ltafvqqvekrfggldglvnnaavegilstmrvadidsaldinlkgqlyltklvtakllk rgagsvvnvssinalrghsgltvysatkaamdgltrslakelgprgirvnsvspgyfssd qtlsrierrtplgrlgtqqevadlilylvdrgtfvtgqniavdggft
Timeline for d4yxfb_: