SCOPe 2.08: Domain d4yxfb_: 4yxf B:

Lineage for d4yxfb_ (4yxf B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Pseudomonas fluorescens [TaxId:294] [315515] (1 PDB entry)

8. Domain d4yxfb_: 4yxf B: [315528]
   automated match to d3gdfa_

Details for d4yxfb_

PDB Entry: 4yxf, 2.7 Å

PDB Description: mups, a 3-oxoacyl (acp) reductase involved in mupirocin biosynthesis

PDB Compounds: (B:) MupS

SCOPe Domain Sequences for d4yxfb_:

Sequence, based on SEQRES records:

>d4yxfb_ c.2.1.0 (B:) automated matches {Pseudomonas fluorescens [TaxId: 294]}
kgtiivsggsqglglttvrcfleagynvatfsrrespavtelseradfhwqaldctdysa
ltafvqqvekrfggldglvnnaatgvegilstmrvadidsaldinlkgqlyltklvtakl
lkrgagsvvnvssinalrghsgltvysatkaamdgltrslakelgprgirvnsvspgyfs
sdmvkdlspqtlsrierrtplgrlgtqqevadlilylvdrgtfvtgqniavdggft

Sequence, based on observed residues (ATOM records):

>d4yxfb_ c.2.1.0 (B:) automated matches {Pseudomonas fluorescens [TaxId: 294]}
kgtiivsggsqglglttvrcfleagynvatfsrrespavtelseradfhwqaldctdysa
ltafvqqvekrfggldglvnnaavegilstmrvadidsaldinlkgqlyltklvtakllk
rgagsvvnvssinalrghsgltvysatkaamdgltrslakelgprgirvnsvspgyfssd
qtlsrierrtplgrlgtqqevadlilylvdrgtfvtgqniavdggft

Timeline for d4yxfb_:

• d4yxfb_ first appeared in SCOPe 2.06
  
• d4yxfb_ appears in SCOPe 2.07