Lineage for d4yxfb_ (4yxf B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2426096Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2426097Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2430344Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2430345Protein automated matches [190069] (247 species)
    not a true protein
  7. 2432087Species Pseudomonas fluorescens [TaxId:294] [315515] (1 PDB entry)
  8. 2432089Domain d4yxfb_: 4yxf B: [315528]
    automated match to d3gdfa_

Details for d4yxfb_

PDB Entry: 4yxf (more details), 2.7 Å

PDB Description: mups, a 3-oxoacyl (acp) reductase involved in mupirocin biosynthesis
PDB Compounds: (B:) MupS

SCOPe Domain Sequences for d4yxfb_:

Sequence, based on SEQRES records: (download)

>d4yxfb_ c.2.1.0 (B:) automated matches {Pseudomonas fluorescens [TaxId: 294]}
kgtiivsggsqglglttvrcfleagynvatfsrrespavtelseradfhwqaldctdysa
ltafvqqvekrfggldglvnnaatgvegilstmrvadidsaldinlkgqlyltklvtakl
lkrgagsvvnvssinalrghsgltvysatkaamdgltrslakelgprgirvnsvspgyfs
sdmvkdlspqtlsrierrtplgrlgtqqevadlilylvdrgtfvtgqniavdggft

Sequence, based on observed residues (ATOM records): (download)

>d4yxfb_ c.2.1.0 (B:) automated matches {Pseudomonas fluorescens [TaxId: 294]}
kgtiivsggsqglglttvrcfleagynvatfsrrespavtelseradfhwqaldctdysa
ltafvqqvekrfggldglvnnaavegilstmrvadidsaldinlkgqlyltklvtakllk
rgagsvvnvssinalrghsgltvysatkaamdgltrslakelgprgirvnsvspgyfssd
qtlsrierrtplgrlgtqqevadlilylvdrgtfvtgqniavdggft

SCOPe Domain Coordinates for d4yxfb_:

Click to download the PDB-style file with coordinates for d4yxfb_.
(The format of our PDB-style files is described here.)

Timeline for d4yxfb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4yxfa_