SCOPe 2.06: Domain d4yy9a_: 4yy9 A:

Lineage for d4yy9a_ (4yy9 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.0: automated matches [227246] (1 protein)
   not a true family

6. Protein automated matches [227017] (34 species)
   not a true protein

7. Species Unidentified influenza virus [TaxId:119212] [312272] (6 PDB entries)

8. Domain d4yy9a_: 4yy9 A: [315526]
   Other proteins in same PDB: d4yy9b_
   automated match to d4xkgc_
   complexed with bma, nag

Details for d4yy9a_

PDB Entry: 4yy9, 2.6 Å

PDB Description: the structure of hemagglutinin from a h6n1 influenza virus (a/taiwan/2/2013)

PDB Compounds: (A:) ha1

SCOPe Domain Sequences for d4yy9a_:

Sequence; same for both SEQRES and ATOM records:

>d4yy9a_ b.19.1.0 (A:) automated matches {Unidentified influenza virus [TaxId: 119212]}
dkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdctiegw
ilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfemfpks
twagvdtsrgvtnacpsytldssfyrnlvwlvktdsatypvikgtynntgtqpilyfwgv
hhpldttvqdnlygsgdkyvrmgtesmnfakspeiaarpavngqrsridyywsvlrpget
lnvesngnliapwyaykfvstnkkgavfksdlpiencdatcqtitgvlrtnktfqnvspl
wigecpkyvkseslrlatglrnvpq

Timeline for d4yy9a_:

• d4yy9a_ is new in SCOPe 2.06-stable
  
• d4yy9a_ appears in SCOPe 2.07
  
• d4yy9a_ appears in the current release, SCOPe 2.08