Lineage for d5i28a_ (5i28 A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2043106Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2043107Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2043108Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 2043186Protein Azurin [49530] (6 species)
  7. 2043217Species Pseudomonas aeruginosa [TaxId:287] [49533] (90 PDB entries)
    Uniprot P00282
  8. 2043443Domain d5i28a_: 5i28 A: [315525]
    automated match to d1jzga_
    complexed with cu, gol

Details for d5i28a_

PDB Entry: 5i28 (more details), 1.95 Å

PDB Description: azurin t30r1, crystal form ii
PDB Compounds: (A:) Azurin

SCOPe Domain Sequences for d5i28a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5i28a_ b.6.1.1 (A:) Azurin {Pseudomonas aeruginosa [TaxId: 287]}
aecsvdiqgndqmqfntnaitvdksckqfcvnlshpgnlpknvmghnwvlstaadmqgvv
tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
mkgtltlk

SCOPe Domain Coordinates for d5i28a_:

Click to download the PDB-style file with coordinates for d5i28a_.
(The format of our PDB-style files is described here.)

Timeline for d5i28a_: