| Class h: Coiled coil proteins [57942] (7 folds) |
| Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) ![]() |
| Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
| Protein automated matches [254646] (29 species) not a true protein |
| Species Unidentified influenza virus [TaxId:119212] [312202] (5 PDB entries) |
| Domain d4yybb_: 4yyb B: [315521] Other proteins in same PDB: d4yyba_ automated match to d3s12b_ complexed with nag |
PDB Entry: 4yyb (more details), 2.61 Å
SCOPe Domain Sequences for d4yybb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4yybb_ h.3.1.1 (B:) automated matches {Unidentified influenza virus [TaxId: 119212]}
gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypky
Timeline for d4yybb_: