Lineage for d4yybb_ (4yyb B:)

  1. Root: SCOPe 2.07
  2. 2590057Class h: Coiled coil proteins [57942] (7 folds)
  3. 2591558Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2591559Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2591560Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2592030Protein automated matches [254646] (30 species)
    not a true protein
  7. 2592324Species Unidentified influenza virus [TaxId:119212] [312202] (5 PDB entries)
  8. 2592326Domain d4yybb_: 4yyb B: [315521]
    Other proteins in same PDB: d4yyba_
    automated match to d3s12b_
    complexed with bma, gal, nag, sia

Details for d4yybb_

PDB Entry: 4yyb (more details), 2.61 Å

PDB Description: the structure of hemagglutinin from a h6n1 influenza virus (a/taiwan/2/2013) in complex with human receptor analog 6'slnln
PDB Compounds: (B:) ha2

SCOPe Domain Sequences for d4yybb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yybb_ h.3.1.1 (B:) automated matches {Unidentified influenza virus [TaxId: 119212]}
gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypky

SCOPe Domain Coordinates for d4yybb_:

Click to download the PDB-style file with coordinates for d4yybb_.
(The format of our PDB-style files is described here.)

Timeline for d4yybb_: