Lineage for d1ndha2 (1ndh A:126-272)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 693238Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 693239Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 693240Family c.25.1.1: Reductases [52344] (4 proteins)
  6. 693241Protein cytochrome b5 reductase [52357] (3 species)
  7. 693244Species Pig (Sus scrofa), liver [TaxId:9823] [52358] (1 PDB entry)
  8. 693245Domain d1ndha2: 1ndh A:126-272 [31552]
    Other proteins in same PDB: d1ndha1
    complexed with fad

Details for d1ndha2

PDB Entry: 1ndh (more details), 2.1 Å

PDB Description: crystal structure of nadh-cytochrome b5 reductase from pig liver at 2.4 angstroms resolution
PDB Compounds: (A:) cytochrome b5 reductase

SCOP Domain Sequences for d1ndha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ndha2 c.25.1.1 (A:126-272) cytochrome b5 reductase {Pig (Sus scrofa), liver [TaxId: 9823]}
gkfairpdkksspviktvksvgmiaggtgitpmlqviraimkdpddhtvchllfanqtek
dillrpeleelrnehsarfklwytvdrapeawdysqgfvneemirdhlpppeeeplvlmc
gpppmiqyaclpnlervghpkercfaf

SCOP Domain Coordinates for d1ndha2:

Click to download the PDB-style file with coordinates for d1ndha2.
(The format of our PDB-style files is described here.)

Timeline for d1ndha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ndha1