![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families) ![]() binds NADP differently than classical Rossmann-fold N-terminal FAD-linked domain contains (6,10) barrel |
![]() | Family c.25.1.1: Reductases [52344] (4 proteins) |
![]() | Protein cytochrome b5 reductase [52357] (3 species) |
![]() | Species Pig (Sus scrofa), liver [TaxId:9823] [52358] (1 PDB entry) |
![]() | Domain d1ndha2: 1ndh A:126-272 [31552] Other proteins in same PDB: d1ndha1 complexed with fad |
PDB Entry: 1ndh (more details), 2.1 Å
SCOP Domain Sequences for d1ndha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ndha2 c.25.1.1 (A:126-272) cytochrome b5 reductase {Pig (Sus scrofa), liver [TaxId: 9823]} gkfairpdkksspviktvksvgmiaggtgitpmlqviraimkdpddhtvchllfanqtek dillrpeleelrnehsarfklwytvdrapeawdysqgfvneemirdhlpppeeeplvlmc gpppmiqyaclpnlervghpkercfaf
Timeline for d1ndha2: