Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families) binds NADP differently than classical Rossmann-fold N-terminal FAD-linked domain contains (6,10) barrel |
Family c.25.1.1: Reductases [52344] (4 proteins) |
Protein cytochrome b5 reductase [52357] (3 species) |
Species Pig (Sus scrofa), liver [TaxId:9823] [52358] (1 PDB entry) |
Domain d1ndh_2: 1ndh 126-272 [31552] Other proteins in same PDB: d1ndh_1 complexed with fad |
PDB Entry: 1ndh (more details), 2.1 Å
SCOP Domain Sequences for d1ndh_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ndh_2 c.25.1.1 (126-272) cytochrome b5 reductase {Pig (Sus scrofa), liver} gkfairpdkksspviktvksvgmiaggtgitpmlqviraimkdpddhtvchllfanqtek dillrpeleelrnehsarfklwytvdrapeawdysqgfvneemirdhlpppeeeplvlmc gpppmiqyaclpnlervghpkercfaf
Timeline for d1ndh_2: