Lineage for d1ndh_2 (1ndh 126-272)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22422Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
  4. 22423Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families) (S)
  5. 22424Family c.25.1.1: Reductases [52344] (4 proteins)
  6. 22425Protein cytochrome b5 reductase [52357] (1 species)
  7. 22426Species Pig (Sus scrofa), liver [TaxId:9823] [52358] (1 PDB entry)
  8. 22427Domain d1ndh_2: 1ndh 126-272 [31552]
    Other proteins in same PDB: d1ndh_1

Details for d1ndh_2

PDB Entry: 1ndh (more details), 2.1 Å

PDB Description: crystal structure of nadh-cytochrome b5 reductase from pig liver at 2.4 angstroms resolution

SCOP Domain Sequences for d1ndh_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ndh_2 c.25.1.1 (126-272) cytochrome b5 reductase {Pig (Sus scrofa), liver}
gkfairpdkksspviktvksvgmiaggtgitpmlqviraimkdpddhtvchllfanqtek
dillrpeleelrnehsarfklwytvdrapeawdysqgfvneemirdhlpppeeeplvlmc
gpppmiqyaclpnlervghpkercfaf

SCOP Domain Coordinates for d1ndh_2:

Click to download the PDB-style file with coordinates for d1ndh_2.
(The format of our PDB-style files is described here.)

Timeline for d1ndh_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ndh_1