Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families) binds NADP differently than classical Rossmann-fold N-terminal FAD-linked domain contains (6,10) barrel |
Family c.25.1.1: Reductases [52344] (4 proteins) |
Protein Nitrate reductase [52355] (1 species) |
Species Corn (Zea mays) [TaxId:4577] [52356] (3 PDB entries) |
Domain d1cnea2: 1cne A:125-270 [31551] Other proteins in same PDB: d1cnea1 complexed with fad; mutant |
PDB Entry: 1cne (more details), 3 Å
SCOP Domain Sequences for d1cnea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cnea2 c.25.1.1 (A:125-270) Nitrate reductase {Corn (Zea mays) [TaxId: 4577]} gsfvingkqrnarrlamicggsgitpmyqiiqavlrdqpedhtemhlvyanrteddillr deldrwaaeypdrlkvwyvidqvkrpeegwkysvgfvteavlrehvpeggddtlalasgp ppmiqfaispnlekmkydmansfvvf
Timeline for d1cnea2: