SCOP 1.57: Domain d1cne_2: 1cne 125-270

Lineage for d1cne_2 (1cne 125-270)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)

4. Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families)

5. Family c.25.1.1: Reductases [52344] (4 proteins)

6. Protein Nitrate reductase [52355] (1 species)

7. Species Corn (Zea mays) [TaxId:4577] [52356] (3 PDB entries)

8. Domain d1cne_2: 1cne 125-270 [31551]
   Other proteins in same PDB: d1cne_1

Details for d1cne_2

PDB Entry: 1cne, 3 Å

PDB Description: structural studies on corn nitrate reductase: refined structure of the cytochrome b reductase fragment at 2.5 angstroms, its adp complex and an active site mutant and modeling of the cytochrome b domain

SCOP Domain Sequences for d1cne_2:

Sequence; same for both SEQRES and ATOM records:

>d1cne_2 c.25.1.1 (125-270) Nitrate reductase {Corn (Zea mays)}
gsfvingkqrnarrlamicggsgitpmyqiiqavlrdqpedhtemhlvyanrteddillr
deldrwaaeypdrlkvwyvidqvkrpeegwkysvgfvteavlrehvpeggddtlalasgp
ppmiqfaispnlekmkydmansfvvf

Timeline for d1cne_2:

• d1cne_2 first appeared (with stable ids) in SCOP 1.55
  
• d1cne_2 appears in SCOP 1.59
  
• d1cne_2 appears in the current release, SCOPe 2.08, called d1cnea2