Lineage for d5b18a_ (5b18 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2799129Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2799130Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2799131Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 2800628Protein automated matches [190433] (12 species)
    not a true protein
  7. 2800672Species Human immunodeficiency virus 1 [TaxId:11676] [187327] (32 PDB entries)
  8. 2800720Domain d5b18a_: 5b18 A: [315507]
    automated match to d3oqda_
    complexed with act, cl

Details for d5b18a_

PDB Entry: 5b18 (more details), 1.8 Å

PDB Description: crystal structure of a darunavir resistant hiv-1 protease
PDB Compounds: (A:) Protease

SCOPe Domain Sequences for d5b18a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b18a_ b.50.1.1 (A:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
pqitlwqrpiitikiggqlkeailntgaddtifeemnlpgrwkpkivggvgglvkvreye
qipieicgrkvistvligptpfniigrnvmtqlgctlnf

SCOPe Domain Coordinates for d5b18a_:

Click to download the PDB-style file with coordinates for d5b18a_.
(The format of our PDB-style files is described here.)

Timeline for d5b18a_: