Lineage for d4yy9b_ (4yy9 B:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3041482Protein automated matches [254646] (29 species)
    not a true protein
  7. 3041789Species Unidentified influenza virus [TaxId:119212] [312202] (5 PDB entries)
  8. 3041790Domain d4yy9b_: 4yy9 B: [315502]
    Other proteins in same PDB: d4yy9a_
    automated match to d3s12b_
    complexed with nag

Details for d4yy9b_

PDB Entry: 4yy9 (more details), 2.6 Å

PDB Description: the structure of hemagglutinin from a h6n1 influenza virus (a/taiwan/2/2013)
PDB Compounds: (B:) ha2

SCOPe Domain Sequences for d4yy9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yy9b_ h.3.1.1 (B:) automated matches {Unidentified influenza virus [TaxId: 119212]}
gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypky

SCOPe Domain Coordinates for d4yy9b_:

Click to download the PDB-style file with coordinates for d4yy9b_.
(The format of our PDB-style files is described here.)

Timeline for d4yy9b_: