SCOPe 2.08: Domain d4yy9b_: 4yy9 B:

Lineage for d4yy9b_ (4yy9 B:)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein automated matches [254646] (29 species)
   not a true protein

7. Species Unidentified influenza virus [TaxId:119212] [312202] (5 PDB entries)

8. Domain d4yy9b_: 4yy9 B: [315502]
   Other proteins in same PDB: d4yy9a_
   automated match to d3s12b_
   complexed with nag

Details for d4yy9b_

PDB Entry: 4yy9, 2.6 Å

PDB Description: the structure of hemagglutinin from a h6n1 influenza virus (a/taiwan/2/2013)

PDB Compounds: (B:) ha2

SCOPe Domain Sequences for d4yy9b_:

Sequence; same for both SEQRES and ATOM records:

>d4yy9b_ h.3.1.1 (B:) automated matches {Unidentified influenza virus [TaxId: 119212]}
gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypky

Timeline for d4yy9b_:

• d4yy9b_ first appeared in SCOPe 2.06
  
• d4yy9b_ appears in SCOPe 2.07