Lineage for d4yyva_ (4yyv A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2927640Family d.3.1.0: automated matches [191342] (1 protein)
    not a true family
  6. 2927641Protein automated matches [190230] (23 species)
    not a true protein
  7. 2927662Species Ficus carica [TaxId:3494] [315499] (5 PDB entries)
  8. 2927668Domain d4yyva_: 4yyv A: [315500]
    automated match to d1s4vb_
    complexed with 16p, so4

Details for d4yyva_

PDB Entry: 4yyv (more details), 1.9 Å

PDB Description: ficin isoform c crystal form ii
PDB Compounds: (A:) Ficin isoform C

SCOPe Domain Sequences for d4yyva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yyva_ d.3.1.0 (A:) automated matches {Ficus carica [TaxId: 3494]}
lpetvdwriqgavnpirnqgrcgscwafsvvvvvegiskivtdelpslseqqlvdcatsy
knlgcsggwmtkaydyiiknggitsqsnypytakkgecnkdlasqivatidsyehvprnn
enalkkavanqpvsvtieaggrafelyksgvfvgscgtkldhavvaigygsendvdywlv
rnswgtnwgergyiklqrnvaeptgkcgiamqstypvkkta

SCOPe Domain Coordinates for d4yyva_:

Click to download the PDB-style file with coordinates for d4yyva_.
(The format of our PDB-style files is described here.)

Timeline for d4yyva_: