Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) binds NADP differently than classical Rossmann-fold N-terminal FAD-linked domain contains (6,10) barrel |
Family c.25.1.1: Reductases [52344] (5 proteins) |
Protein Nitrate reductase [52355] (1 species) |
Species Maize (Zea mays) [TaxId:4577] [52356] (3 PDB entries) |
Domain d1cnfa2: 1cnf A:125-270 [31550] Other proteins in same PDB: d1cnfa1 complexed with adp, fad; mutant |
PDB Entry: 1cnf (more details), 2.7 Å
SCOPe Domain Sequences for d1cnfa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cnfa2 c.25.1.1 (A:125-270) Nitrate reductase {Maize (Zea mays) [TaxId: 4577]} gsfvingkqrnarrlamicggsgitpmyqiiqavlrdqpedhtemhlvyanrteddillr deldrwaaeypdrlkvwyvidqvkrpeegwkysvgfvteavlrehvpeggddtlalacgp ppmiqfaispnlekmkydmansfvvf
Timeline for d1cnfa2: