Lineage for d1cnfa2 (1cnf A:125-270)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1841107Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 1841108Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 1841109Family c.25.1.1: Reductases [52344] (5 proteins)
  6. 1841188Protein Nitrate reductase [52355] (1 species)
  7. 1841189Species Maize (Zea mays) [TaxId:4577] [52356] (3 PDB entries)
  8. 1841191Domain d1cnfa2: 1cnf A:125-270 [31550]
    Other proteins in same PDB: d1cnfa1
    complexed with adp, fad; mutant

Details for d1cnfa2

PDB Entry: 1cnf (more details), 2.7 Å

PDB Description: structural studies on corn nitrate reductase: refined structure of the cytochrome b reductase fragment at 2.5 angstroms, its adp complex and an active site mutant and modeling of the cytochrome b domain
PDB Compounds: (A:) nitrate reductase

SCOPe Domain Sequences for d1cnfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cnfa2 c.25.1.1 (A:125-270) Nitrate reductase {Maize (Zea mays) [TaxId: 4577]}
gsfvingkqrnarrlamicggsgitpmyqiiqavlrdqpedhtemhlvyanrteddillr
deldrwaaeypdrlkvwyvidqvkrpeegwkysvgfvteavlrehvpeggddtlalacgp
ppmiqfaispnlekmkydmansfvvf

SCOPe Domain Coordinates for d1cnfa2:

Click to download the PDB-style file with coordinates for d1cnfa2.
(The format of our PDB-style files is described here.)

Timeline for d1cnfa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cnfa1