Lineage for d1cnf_2 (1cnf 125-270)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 68846Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
  4. 68847Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families) (S)
  5. 68848Family c.25.1.1: Reductases [52344] (4 proteins)
  6. 68900Protein Nitrate reductase [52355] (1 species)
  7. 68901Species Corn (Zea mays) [TaxId:4577] [52356] (3 PDB entries)
  8. 68903Domain d1cnf_2: 1cnf 125-270 [31550]
    Other proteins in same PDB: d1cnf_1

Details for d1cnf_2

PDB Entry: 1cnf (more details), 2.7 Å

PDB Description: structural studies on corn nitrate reductase: refined structure of the cytochrome b reductase fragment at 2.5 angstroms, its adp complex and an active site mutant and modeling of the cytochrome b domain

SCOP Domain Sequences for d1cnf_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cnf_2 c.25.1.1 (125-270) Nitrate reductase {Corn (Zea mays)}
gsfvingkqrnarrlamicggsgitpmyqiiqavlrdqpedhtemhlvyanrteddillr
deldrwaaeypdrlkvwyvidqvkrpeegwkysvgfvteavlrehvpeggddtlalacgp
ppmiqfaispnlekmkydmansfvvf

SCOP Domain Coordinates for d1cnf_2:

Click to download the PDB-style file with coordinates for d1cnf_2.
(The format of our PDB-style files is described here.)

Timeline for d1cnf_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cnf_1