Lineage for d5huma_ (5hum A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2417088Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2417089Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2417090Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins)
  6. 2417430Protein automated matches [193245] (22 species)
    not a true protein
  7. 2417457Species Influenza A virus (a/chicken/sichuan/ncjpl1/2014(h5n6)) [TaxId:1529593] [315491] (1 PDB entry)
  8. 2417458Domain d5huma_: 5hum A: [315495]
    automated match to d4qn4a_
    complexed with ca, nag

Details for d5huma_

PDB Entry: 5hum (more details), 1.6 Å

PDB Description: the crystal structure of neuraminidase from a/sichuan/26221/2014 influenza virus
PDB Compounds: (A:) Neuraminidase

SCOPe Domain Sequences for d5huma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5huma_ b.68.1.1 (A:) automated matches {Influenza A virus (a/chicken/sichuan/ncjpl1/2014(h5n6)) [TaxId: 1529593]}
ghllnltkplcevnswhilskdnairigedahiivtrepylscdpqgcrmfalsqgttlr
gkhangtihdrspfralvswemgqapspyntrvecigwsstschdgisrmsicisgpnnn
asavvwyggrpvteipswagnilrtqesecvchggicpvvmtdgpannraetkiiyfkeg
kikkieelkgdaqhieecscygasemikcicrdnwkganrpvitidpemmthtskylcsk
iltdtsrpndptngkceapitggspdpgvkgfafldgenswlgrtiskdsrsgyemlkvp
naetdtqsgaishqiivnnqnwsgysgafidywankecfnpcfyvelirgrpkessvlwt
snsivalcgskerlgswswhdgaeiiyfk

SCOPe Domain Coordinates for d5huma_:

Click to download the PDB-style file with coordinates for d5huma_.
(The format of our PDB-style files is described here.)

Timeline for d5huma_: