Class b: All beta proteins [48724] (178 folds) |
Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies) consists of six 4-stranded beta-sheet motifs; meander |
Superfamily b.68.1: Sialidases [50939] (3 families) |
Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins) |
Protein automated matches [193245] (22 species) not a true protein |
Species Influenza A virus (a/chicken/sichuan/ncjpl1/2014(h5n6)) [TaxId:1529593] [315491] (1 PDB entry) |
Domain d5huma_: 5hum A: [315495] automated match to d4qn4a_ complexed with ca, nag |
PDB Entry: 5hum (more details), 1.6 Å
SCOPe Domain Sequences for d5huma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5huma_ b.68.1.1 (A:) automated matches {Influenza A virus (a/chicken/sichuan/ncjpl1/2014(h5n6)) [TaxId: 1529593]} ghllnltkplcevnswhilskdnairigedahiivtrepylscdpqgcrmfalsqgttlr gkhangtihdrspfralvswemgqapspyntrvecigwsstschdgisrmsicisgpnnn asavvwyggrpvteipswagnilrtqesecvchggicpvvmtdgpannraetkiiyfkeg kikkieelkgdaqhieecscygasemikcicrdnwkganrpvitidpemmthtskylcsk iltdtsrpndptngkceapitggspdpgvkgfafldgenswlgrtiskdsrsgyemlkvp naetdtqsgaishqiivnnqnwsgysgafidywankecfnpcfyvelirgrpkessvlwt snsivalcgskerlgswswhdgaeiiyfk
Timeline for d5huma_: