SCOP 1.71: Domain d2cnd_2: 2cnd 125-270

Lineage for d2cnd_2 (2cnd 125-270)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
   3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families)
   binds NADP differently than classical Rossmann-fold
   N-terminal FAD-linked domain contains (6,10) barrel

5. Family c.25.1.1: Reductases [52344] (4 proteins)

6. Protein Nitrate reductase [52355] (1 species)

7. Species Corn (Zea mays) [TaxId:4577] [52356] (3 PDB entries)

8. Domain d2cnd_2: 2cnd 125-270 [31549]
   Other proteins in same PDB: d2cnd_1
   complexed with fad

Details for d2cnd_2

PDB Entry: 2cnd, 2.5 Å

PDB Description: structural studies on corn nitrate reductase: refined structure of the cytochrome b reductase fragment at 2.5 angstroms, its adp complex and an active site mutant and modeling of the cytochrome b domain

SCOP Domain Sequences for d2cnd_2:

Sequence; same for both SEQRES and ATOM records:

>d2cnd_2 c.25.1.1 (125-270) Nitrate reductase {Corn (Zea mays)}
gsfvingkqrnarrlamicggsgitpmyqiiqavlrdqpedhtemhlvyanrteddillr
deldrwaaeypdrlkvwyvidqvkrpeegwkysvgfvteavlrehvpeggddtlalacgp
ppmiqfaispnlekmkydmansfvvf

Timeline for d2cnd_2:

• d2cnd_2 first appeared (with stable ids) in SCOP 1.55
  
• d2cnd_2 appears in SCOP 1.69
  
• d2cnd_2 is called d2cnda2 in SCOP 1.73
  
• d2cnd_2 appears in the current release, SCOPe 2.08, called d2cnda2