Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
Superfamily d.93.1: SH2 domain [55550] (2 families) |
Family d.93.1.0: automated matches [191409] (1 protein) not a true family |
Protein automated matches [190561] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187549] (49 PDB entries) |
Domain d5ibma1: 5ibm A:4-110 [315486] Other proteins in same PDB: d5ibma3, d5ibmb3 automated match to d2shpa2 mutant |
PDB Entry: 5ibm (more details), 2.18 Å
SCOPe Domain Sequences for d5ibma1:
Sequence, based on SEQRES records: (download)
>d5ibma1 d.93.1.0 (A:4-110) automated matches {Human (Homo sapiens) [TaxId: 9606]} rrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntgdyy dlyggekfatlaelvqyymehhgqlkekngdvielkyplncadptse
>d5ibma1 d.93.1.0 (A:4-110) automated matches {Human (Homo sapiens) [TaxId: 9606]} rrwfhpnitgveaenllltrgvdgsflarpspgdftlsvrrngavthikiqntgdyydly ggekfatlaelvqyymehqlkeielkyplncadptse
Timeline for d5ibma1: