SCOPe 2.07: Domain d5hu8f_: 5hu8 F:

Lineage for d5hu8f_ (5hu8 F:)

1. Root: SCOPe 2.07

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.0: automated matches [254278] (1 protein)
   not a true family

6. Protein automated matches [254645] (23 species)
   not a true protein

7. Species Unidentified influenza virus [TaxId:11309] [315420] (1 PDB entry)

8. Domain d5hu8f_: 5hu8 F: [315485]
   Other proteins in same PDB: d5hu8a1, d5hu8a2, d5hu8c1, d5hu8c2, d5hu8e1, d5hu8e2
   automated match to d3m5jb_
   complexed with fuc, nag

Details for d5hu8f_

PDB Entry: 5hu8, 2.45 Å

PDB Description: the crystal structure of hemagglutinin from a/sichuan/26221/2014 (h5n6) influenza virus

PDB Compounds: (F:) hemagglutinin HA2

SCOPe Domain Sequences for d5hu8f_:

Sequence; same for both SEQRES and ATOM records:

>d5hu8f_ h.3.1.0 (F:) automated matches {Unidentified influenza virus [TaxId: 11309]}
ggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmntqfeavgrefn
nlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlydkvrlqlrdnak
elgngcfefyhkcdnkcmesvrngtydypqyseearlkreei

Timeline for d5hu8f_:

• d5hu8f_ first appeared in SCOPe 2.06