![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
![]() | Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) ![]() |
![]() | Family h.3.1.0: automated matches [254278] (1 protein) not a true family |
![]() | Protein automated matches [254645] (26 species) not a true protein |
![]() | Species Unidentified influenza virus [TaxId:11309] [315420] (1 PDB entry) |
![]() | Domain d5hu8f_: 5hu8 F: [315485] Other proteins in same PDB: d5hu8a1, d5hu8a2, d5hu8c1, d5hu8c2, d5hu8e1, d5hu8e2 automated match to d3m5jb_ complexed with fuc, nag |
PDB Entry: 5hu8 (more details), 2.45 Å
SCOPe Domain Sequences for d5hu8f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hu8f_ h.3.1.0 (F:) automated matches {Unidentified influenza virus [TaxId: 11309]} ggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmntqfeavgrefn nlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlydkvrlqlrdnak elgngcfefyhkcdnkcmesvrngtydypqyseearlkreei
Timeline for d5hu8f_: