SCOPe 2.07: Domain d4uhtb_: 4uht B:

Lineage for d4uhtb_ (4uht B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families)
   binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family

5. Family a.4.6.0: automated matches [191513] (1 protein)
   not a true family

6. Protein automated matches [190858] (24 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [315476] (2 PDB entries)

8. Domain d4uhtb_: 4uht B: [315478]
   automated match to d3q9vb_
   complexed with cl

Details for d4uhtb_

PDB Entry: 4uht, 1.15 Å

PDB Description: crystal structure of the dna binding domain of cpxr from e. coli

PDB Compounds: (B:) transcriptional regulatory protein cpxr

SCOPe Domain Sequences for d4uhtb_:

Sequence; same for both SEQRES and ATOM records:

>d4uhtb_ a.4.6.0 (B:) automated matches {Escherichia coli [TaxId: 83333]}
sptlevdalvlnpgrqeasfdgqtleltgteftllyllaqhlgqvvsrehlsqevlgkrl
tpfdhaidmhisnlrrklpdrkdghpwfktlrgrgylmvsaa

Timeline for d4uhtb_:

• d4uhtb_ first appeared in SCOPe 2.06
  
• d4uhtb_ appears in the current release, SCOPe 2.08