Lineage for d4uhtb_ (4uht B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2308617Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) (S)
    binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family
  5. 2308708Family a.4.6.0: automated matches [191513] (1 protein)
    not a true family
  6. 2308709Protein automated matches [190858] (24 species)
    not a true protein
  7. 2308727Species Escherichia coli [TaxId:83333] [315476] (2 PDB entries)
  8. 2308729Domain d4uhtb_: 4uht B: [315478]
    automated match to d3q9vb_
    complexed with cl

Details for d4uhtb_

PDB Entry: 4uht (more details), 1.15 Å

PDB Description: crystal structure of the dna binding domain of cpxr from e. coli
PDB Compounds: (B:) transcriptional regulatory protein cpxr

SCOPe Domain Sequences for d4uhtb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uhtb_ a.4.6.0 (B:) automated matches {Escherichia coli [TaxId: 83333]}
sptlevdalvlnpgrqeasfdgqtleltgteftllyllaqhlgqvvsrehlsqevlgkrl
tpfdhaidmhisnlrrklpdrkdghpwfktlrgrgylmvsaa

SCOPe Domain Coordinates for d4uhtb_:

Click to download the PDB-style file with coordinates for d4uhtb_.
(The format of our PDB-style files is described here.)

Timeline for d4uhtb_: