Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family |
Family a.4.6.0: automated matches [191513] (1 protein) not a true family |
Protein automated matches [190858] (24 species) not a true protein |
Species Escherichia coli [TaxId:83333] [315476] (2 PDB entries) |
Domain d4uhtb_: 4uht B: [315478] automated match to d3q9vb_ complexed with cl |
PDB Entry: 4uht (more details), 1.15 Å
SCOPe Domain Sequences for d4uhtb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uhtb_ a.4.6.0 (B:) automated matches {Escherichia coli [TaxId: 83333]} sptlevdalvlnpgrqeasfdgqtleltgteftllyllaqhlgqvvsrehlsqevlgkrl tpfdhaidmhisnlrrklpdrkdghpwfktlrgrgylmvsaa
Timeline for d4uhtb_: