SCOPe 2.08: Domain d4uhta_: 4uht A:

Lineage for d4uhta_ (4uht A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families)
   binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family

5. Family a.4.6.0: automated matches [191513] (1 protein)
   not a true family

6. Protein automated matches [190858] (25 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [315476] (2 PDB entries)

8. Domain d4uhta_: 4uht A: [315477]
   automated match to d3q9vb_
   complexed with cl

Details for d4uhta_

PDB Entry: 4uht, 1.15 Å

PDB Description: crystal structure of the dna binding domain of cpxr from e. coli

PDB Compounds: (A:) transcriptional regulatory protein cpxr

SCOPe Domain Sequences for d4uhta_:

Sequence; same for both SEQRES and ATOM records:

>d4uhta_ a.4.6.0 (A:) automated matches {Escherichia coli [TaxId: 83333]}
sptlevdalvlnpgrqeasfdgqtleltgteftllyllaqhlgqvvsrehlsqevlgkrl
tpfdhaidmhisnlrrklpdrkdghpwfktlrgrgylmvsaa

Timeline for d4uhta_:

• d4uhta_ first appeared in SCOPe 2.06
  
• d4uhta_ appears in SCOPe 2.07