SCOPe 2.08: Domain d5ifzb_: 5ifz B:

Lineage for d5ifzb_ (5ifz B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.121: Ribose/Galactose isomerase RpiB/AlsB [89622] (1 superfamily)
   3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 21354; topological similarity to a part of the arginase/deacetylase fold

4. Superfamily c.121.1: Ribose/Galactose isomerase RpiB/AlsB [89623] (2 families)

5. Family c.121.1.0: automated matches [191649] (1 protein)
   not a true family

6. Protein automated matches [191196] (11 species)
   not a true protein

7. Species Brucella melitensis [TaxId:224914] [315464] (1 PDB entry)

8. Domain d5ifzb_: 5ifz B: [315465]
   automated match to d3he8a_

Details for d5ifzb_

PDB Entry: 5ifz, 1.6 Å

PDB Description: crystal structure of ribose-5-phosphate isomerase from brucella melitensis 16m

PDB Compounds: (B:) Ribose 5-phosphate isomerase

SCOPe Domain Sequences for d5ifzb_:

Sequence, based on SEQRES records:

>d5ifzb_ c.121.1.0 (B:) automated matches {Brucella melitensis [TaxId: 224914]}
mkvavagdsageglakvladhlkdrfevseisrtdagadafyanlsdrvasavldgtydr
ailvcgtgigvciaankvpgiraalthdtysaeraalsnnaqiitmgarvigaevaktia
daflaqtf

Sequence, based on observed residues (ATOM records):

>d5ifzb_ c.121.1.0 (B:) automated matches {Brucella melitensis [TaxId: 224914]}
mkvavagdsageglakvladhlkdrfevseisnlsdrvasavldgtydrailvcgtgigv
ciaankvpgiraalthdtysaeraalsnnaqiitmgarvigaevaktiadaflaqtf

Timeline for d5ifzb_:

• d5ifzb_ first appeared in SCOPe 2.06
  
• d5ifzb_ appears in SCOPe 2.07