Lineage for d5ifzb_ (5ifz B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2921985Fold c.121: Ribose/Galactose isomerase RpiB/AlsB [89622] (1 superfamily)
    3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 21354; topological similarity to a part of the arginase/deacetylase fold
  4. 2921986Superfamily c.121.1: Ribose/Galactose isomerase RpiB/AlsB [89623] (2 families) (S)
  5. 2922038Family c.121.1.0: automated matches [191649] (1 protein)
    not a true family
  6. 2922039Protein automated matches [191196] (11 species)
    not a true protein
  7. 2922043Species Brucella melitensis [TaxId:224914] [315464] (1 PDB entry)
  8. 2922045Domain d5ifzb_: 5ifz B: [315465]
    automated match to d3he8a_

Details for d5ifzb_

PDB Entry: 5ifz (more details), 1.6 Å

PDB Description: crystal structure of ribose-5-phosphate isomerase from brucella melitensis 16m
PDB Compounds: (B:) Ribose 5-phosphate isomerase

SCOPe Domain Sequences for d5ifzb_:

Sequence, based on SEQRES records: (download)

>d5ifzb_ c.121.1.0 (B:) automated matches {Brucella melitensis [TaxId: 224914]}
mkvavagdsageglakvladhlkdrfevseisrtdagadafyanlsdrvasavldgtydr
ailvcgtgigvciaankvpgiraalthdtysaeraalsnnaqiitmgarvigaevaktia
daflaqtf

Sequence, based on observed residues (ATOM records): (download)

>d5ifzb_ c.121.1.0 (B:) automated matches {Brucella melitensis [TaxId: 224914]}
mkvavagdsageglakvladhlkdrfevseisnlsdrvasavldgtydrailvcgtgigv
ciaankvpgiraalthdtysaeraalsnnaqiitmgarvigaevaktiadaflaqtf

SCOPe Domain Coordinates for d5ifzb_:

Click to download the PDB-style file with coordinates for d5ifzb_.
(The format of our PDB-style files is described here.)

Timeline for d5ifzb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5ifza_