Lineage for d5i6va2 (5i6v A:111-218)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2571840Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2571841Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2572318Family d.93.1.0: automated matches [191409] (1 protein)
    not a true family
  6. 2572319Protein automated matches [190561] (4 species)
    not a true protein
  7. 2572320Species Human (Homo sapiens) [TaxId:9606] [187549] (78 PDB entries)
  8. 2572353Domain d5i6va2: 5i6v A:111-218 [315461]
    Other proteins in same PDB: d5i6va3, d5i6vb3
    automated match to d2shpa3
    complexed with gol; mutant

Details for d5i6va2

PDB Entry: 5i6v (more details), 1.87 Å

PDB Description: structure of f285s, a cancer-associated mutation of the oncogenic phosphatase shp2
PDB Compounds: (A:) Tyrosine-protein phosphatase non-receptor type 11

SCOPe Domain Sequences for d5i6va2:

Sequence, based on SEQRES records: (download)

>d5i6va2 d.93.1.0 (A:111-218) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rwfhghlsgkeaeklltekgkhgsflvresqshpgdfvlsvrtgddkgesndgkskvthv
mircqelkydvgggerfdsltdlvehykknpmvetlgtvlqlkqplnt

Sequence, based on observed residues (ATOM records): (download)

>d5i6va2 d.93.1.0 (A:111-218) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rwfhghlsgkeaeklltekgkhgsflvresqshpgdfvlsvrtgdkskvthvmircqelk
ydvgggerfdsltdlvehykknpmvetlgtvlqlkqplnt

SCOPe Domain Coordinates for d5i6va2:

Click to download the PDB-style file with coordinates for d5i6va2.
(The format of our PDB-style files is described here.)

Timeline for d5i6va2: