| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) ![]() |
| Family d.38.1.0: automated matches [191325] (1 protein) not a true family |
| Protein automated matches [190143] (42 species) not a true protein |
| Species Staphylococcus aureus [TaxId:158878] [260692] (8 PDB entries) |
| Domain d5hz4b_: 5hz4 B: [315454] automated match to d5egkd_ mutant |
PDB Entry: 5hz4 (more details), 2.5 Å
SCOPe Domain Sequences for d5hz4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hz4b_ d.38.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 158878]}
pmksmseskcyknrqvfpqdtnhhhtmfggtlmanideiaaitamkhagaqvvaastdsv
dflkpiktgdilqyvamvsyagtssmevvvqiriddvfnnkhdlaalsyltfvalddegk
pkhvpgvypeddvekwfydtapqrverrkarrieskqtieyl
Timeline for d5hz4b_: