Lineage for d5hu8d_ (5hu8 D:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3041799Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 3041800Protein automated matches [254645] (42 species)
    not a true protein
  7. 3042045Species Unidentified influenza virus [TaxId:11309] [315420] (5 PDB entries)
  8. 3042047Domain d5hu8d_: 5hu8 D: [315451]
    Other proteins in same PDB: d5hu8a1, d5hu8a2, d5hu8c1, d5hu8c2, d5hu8e1, d5hu8e2
    automated match to d3m5jb_
    complexed with nag

Details for d5hu8d_

PDB Entry: 5hu8 (more details), 2.45 Å

PDB Description: the crystal structure of hemagglutinin from a/sichuan/26221/2014 (h5n6) influenza virus
PDB Compounds: (D:) hemagglutinin HA2

SCOPe Domain Sequences for d5hu8d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hu8d_ h.3.1.0 (D:) automated matches {Unidentified influenza virus [TaxId: 11309]}
ggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmntqfeavgrefn
nlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlydkvrlqlrdnak
elgngcfefyhkcdnkcmesvrngtydypqyseearlkreei

SCOPe Domain Coordinates for d5hu8d_:

Click to download the PDB-style file with coordinates for d5hu8d_.
(The format of our PDB-style files is described here.)

Timeline for d5hu8d_: