Lineage for d1qfja2 (1qfj A:98-232)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 579859Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 579860Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 579861Family c.25.1.1: Reductases [52344] (4 proteins)
  6. 579925Protein NAD(P)H:flavin oxidoreductase [52353] (1 species)
  7. 579926Species Escherichia coli [TaxId:562] [52354] (1 PDB entry)
  8. 579927Domain d1qfja2: 1qfj A:98-232 [31545]
    Other proteins in same PDB: d1qfja1, d1qfjb1, d1qfjc1, d1qfjd1

Details for d1qfja2

PDB Entry: 1qfj (more details), 2.2 Å

PDB Description: crystal structure of nad(p)h:flavin oxidoreductase from escherichia coli

SCOP Domain Sequences for d1qfja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qfja2 c.25.1.1 (A:98-232) NAD(P)H:flavin oxidoreductase {Escherichia coli}
rddeerpmiliaggtgfsyarsilltalarnpnrditiywggreeqhlydlcelealslk
hpglqvvpvveqpeagwrgrtgtvltavlqdhgtlaehdiyiagrfemakiardlfcser
naredrlfgdafafi

SCOP Domain Coordinates for d1qfja2:

Click to download the PDB-style file with coordinates for d1qfja2.
(The format of our PDB-style files is described here.)

Timeline for d1qfja2: