Lineage for d5i66b1 (5i66 B:21-127)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (30 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2759674Domain d5i66b1: 5i66 B:21-127 [315440]
    Other proteins in same PDB: d5i66a_, d5i66b2
    automated match to d1h3pl1

Details for d5i66b1

PDB Entry: 5i66 (more details), 1.62 Å

PDB Description: x-ray structure of the fab fragment of 8b6, a murine monoclonal antibody specific for the human serotonin transporter
PDB Compounds: (B:) 8B6 antibody, light chain

SCOPe Domain Sequences for d5i66b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5i66b1 b.1.1.0 (B:21-127) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmtqshkfmstsvgdrvsitckasqdvstavawyqqkpgqspklliysasyrytgvpd
rftgsgsgtdftftissvqaedlavyycqqhysiprtfgggtkleik

SCOPe Domain Coordinates for d5i66b1:

Click to download the PDB-style file with coordinates for d5i66b1.
(The format of our PDB-style files is described here.)

Timeline for d5i66b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5i66b2
View in 3D
Domains from other chains:
(mouse over for more information)
d5i66a_