SCOP 1.75: Domain d1a8pa2: 1a8p A:101-258

Lineage for d1a8pa2 (1a8p A:101-258)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
   3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families)
   binds NADP differently than classical Rossmann-fold
   N-terminal FAD-linked domain contains (6,10) barrel

5. Family c.25.1.1: Reductases [52344] (4 proteins)

6. Protein Ferredoxin reductase (flavodoxin reductase) [52345] (8 species)

7. Species Azotobacter vinelandii [TaxId:354] [52352] (1 PDB entry)

8. Domain d1a8pa2: 1a8p A:101-258 [31544]
   Other proteins in same PDB: d1a8pa1
   complexed with fad

Details for d1a8pa2

PDB Entry: 1a8p, 2 Å

PDB Description: ferredoxin reductase from azotobacter vinelandii

PDB Compounds: (A:) nadph:ferredoxin oxidoreductase

SCOP Domain Sequences for d1a8pa2:

Sequence; same for both SEQRES and ATOM records:

>d1a8pa2 c.25.1.1 (A:101-258) Ferredoxin reductase (flavodoxin reductase) {Azotobacter vinelandii [TaxId: 354]}
tsdllpgkhlymlstgtglapfmsliqdpevyerfekvvlihgvrqvnelayqqfitehl
pqseyfgeavkekliyyptvtresfhnqgrltdlmrsgklfediglppinpqddramicg
spsmldescevldgfglkisprmgepgdylierafvek

Timeline for d1a8pa2:

• d1a8pa2 first appeared (with stable ids) in SCOP 1.55, called d1a8p_2
  
• d1a8pa2 appears in SCOP 1.73
  
• d1a8pa2 appears in SCOPe 2.01
  
• d1a8pa2 appears in the current release, SCOPe 2.08