Lineage for d5fjqb_ (5fjq B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2766140Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2766141Protein automated matches [190226] (81 species)
    not a true protein
  7. 2766510Species Pseudomonas cellulosa (Cellvibrio japonicus) [TaxId:155077] [315362] (1 PDB entry)
  8. 2766512Domain d5fjqb_: 5fjq B: [315437]
    automated match to d2bena_
    complexed with cu

Details for d5fjqb_

PDB Entry: 5fjq (more details), 1.85 Å

PDB Description: structural and functional analysis of a lytic polysaccharide monooxygenase important for efficient utilization of chitin in cellvibrio japonicus
PDB Compounds: (B:) carbohydrate binding protein, putative, cpb33a

SCOPe Domain Sequences for d5fjqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fjqb_ b.1.18.0 (B:) automated matches {Pseudomonas cellulosa (Cellvibrio japonicus) [TaxId: 155077]}
hgyvsspksrviqckengienpthpaciaakaagngglytpqevavggvrdnhdyyipdg
rlcsanranlfgmdlarndwpatsvtpgarefvwtntaahktkyfryyitpqgydhsqpl
rwsdlqlihdsgpadqewvsthnvilpyrtgrhiiysiwqrdwdrdaaegfyqcidvdfg

SCOPe Domain Coordinates for d5fjqb_:

Click to download the PDB-style file with coordinates for d5fjqb_.
(The format of our PDB-style files is described here.)

Timeline for d5fjqb_: