Lineage for d1fdr_2 (1fdr 101-248)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 68846Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
  4. 68847Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families) (S)
  5. 68848Family c.25.1.1: Reductases [52344] (4 proteins)
  6. 68852Protein Ferredoxin reductase (flavodoxin reductase) [52345] (8 species)
  7. 68865Species Escherichia coli [TaxId:562] [52351] (1 PDB entry)
  8. 68866Domain d1fdr_2: 1fdr 101-248 [31543]
    Other proteins in same PDB: d1fdr_1

Details for d1fdr_2

PDB Entry: 1fdr (more details), 1.7 Å

PDB Description: flavodoxin reductase from e. coli

SCOP Domain Sequences for d1fdr_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fdr_2 c.25.1.1 (101-248) Ferredoxin reductase (flavodoxin reductase) {Escherichia coli}
devphcetlwmlatgtaigpylsilrlgkdldrfknlvlvhaaryaadlsylplmqelek
ryegklriqtvvsretaagsltgripaliesgelestiglpmnketshvmlcgnpqmvrd
tqqllketrqmtkhlrrrpghmtaehyw

SCOP Domain Coordinates for d1fdr_2:

Click to download the PDB-style file with coordinates for d1fdr_2.
(The format of our PDB-style files is described here.)

Timeline for d1fdr_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fdr_1