Lineage for d1fdr_2 (1fdr 101-248)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily) Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families) 
Family c.25.1.1: Reductases [52344] (4 proteins) Protein Ferredoxin reductase (flavodoxin reductase) [52345] (7 species) Species Escherichia coli [TaxId:562] [52351] (1 PDB entry) 
Domain d1fdr_2: 1fdr 101-248 [31543]
Other proteins in same PDB: d1fdr_1
Details for d1fdr_2
PDB Entry: 1fdr (more details), 1.7 Å
PDB Description: flavodoxin reductase from e. coli
SCOP Domain Sequences for d1fdr_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fdr_2 c.25.1.1 (101-248) Ferredoxin reductase (flavodoxin reductase) {Escherichia coli}
devphcetlwmlatgtaigpylsilrlgkdldrfknlvlvhaaryaadlsylplmqelek
ryegklriqtvvsretaagsltgripaliesgelestiglpmnketshvmlcgnpqmvrd
tqqllketrqmtkhlrrrpghmtaehyw
SCOP Domain Coordinates for d1fdr_2:
Click to download the PDB-style file with coordinates for d1fdr_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fdr_2:
- d1fdr_2 appears in SCOP 1.57
- d1fdr_2 appears in the current release, SCOPe 2.08, called d1fdra2
View in 3D
