Lineage for d1fdra2 (1fdr A:101-248)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2859730Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 2859731Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 2859732Family c.25.1.1: Reductases [52344] (5 proteins)
  6. 2859751Protein Ferredoxin reductase (flavodoxin reductase) [52345] (9 species)
  7. 2859775Species Escherichia coli [TaxId:562] [52351] (1 PDB entry)
  8. 2859776Domain d1fdra2: 1fdr A:101-248 [31543]
    Other proteins in same PDB: d1fdra1
    complexed with fad

Details for d1fdra2

PDB Entry: 1fdr (more details), 1.7 Å

PDB Description: flavodoxin reductase from e. coli
PDB Compounds: (A:) flavodoxin reductase

SCOPe Domain Sequences for d1fdra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fdra2 c.25.1.1 (A:101-248) Ferredoxin reductase (flavodoxin reductase) {Escherichia coli [TaxId: 562]}
devphcetlwmlatgtaigpylsilrlgkdldrfknlvlvhaaryaadlsylplmqelek
ryegklriqtvvsretaagsltgripaliesgelestiglpmnketshvmlcgnpqmvrd
tqqllketrqmtkhlrrrpghmtaehyw

SCOPe Domain Coordinates for d1fdra2:

Click to download the PDB-style file with coordinates for d1fdra2.
(The format of our PDB-style files is described here.)

Timeline for d1fdra2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fdra1