| Class b: All beta proteins [48724] (178 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
| Protein automated matches [190226] (72 species) not a true protein |
| Species Pseudomonas cellulosa (Cellvibrio japonicus) [TaxId:155077] [315362] (1 PDB entry) |
| Domain d5fjqc_: 5fjq C: [315414] automated match to d2bena_ complexed with cu |
PDB Entry: 5fjq (more details), 1.85 Å
SCOPe Domain Sequences for d5fjqc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5fjqc_ b.1.18.0 (C:) automated matches {Pseudomonas cellulosa (Cellvibrio japonicus) [TaxId: 155077]}
hgyvsspksrviqckengienpthpaciaakaagngglytpqevavggvrdnhdyyipdg
rlcsanranlfgmdlarndwpatsvtpgarefvwtntaahktkyfryyitpqgydhsqpl
rwsdlqlihdsgpadqewvsthnvilpyrtgrhiiysiwqrdwdrdaaegfyqcidvdfg
Timeline for d5fjqc_: