Lineage for d5hg0a1 (5hg0 A:1-260)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2442470Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2442471Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2443142Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2443143Protein automated matches [190459] (53 species)
    not a true protein
  7. 2443263Species Francisella tularensis [TaxId:177416] [196438] (3 PDB entries)
  8. 2443266Domain d5hg0a1: 5hg0 A:1-260 [315411]
    Other proteins in same PDB: d5hg0a2, d5hg0b2
    automated match to d3qtta_
    complexed with sam

Details for d5hg0a1

PDB Entry: 5hg0 (more details), 2.4 Å

PDB Description: crystal structure of pantoate-beta-alanine ligase from francisella tularensis complex with sam
PDB Compounds: (A:) Pantothenate synthetase

SCOPe Domain Sequences for d5hg0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hg0a1 c.26.1.0 (A:1-260) automated matches {Francisella tularensis [TaxId: 177416]}
miiadnikqfhsirnslikqqkigfvptmgalhnghislikkaksendvvivsifvnptq
fnnpndyqtypnqlqqdiqilasldvdvlfnpsekdiypdgnllriepkleianilegks
rpghfsgmltvvlkllqitkpnnlylgekdyqqvmlikqlvkdffintkiivcptqrqps
glplssrnknltstdieiankiyeilrqddfsnleeltnkinstgaklqyiqklnnrifl
afyigkvrlidnflketgps

SCOPe Domain Coordinates for d5hg0a1:

Click to download the PDB-style file with coordinates for d5hg0a1.
(The format of our PDB-style files is described here.)

Timeline for d5hg0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5hg0a2