SCOPe 2.08: Domain d5hg0a1: 5hg0 A:1-260

Lineage for d5hg0a1 (5hg0 A:1-260)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.0: automated matches [191377] (1 protein)
   not a true family

6. Protein automated matches [190459] (61 species)
   not a true protein

7. Species Francisella tularensis [TaxId:177416] [196438] (3 PDB entries)

8. Domain d5hg0a1: 5hg0 A:1-260 [315411]
   Other proteins in same PDB: d5hg0a2, d5hg0b2
   automated match to d3qtta_
   complexed with sam

Details for d5hg0a1

PDB Entry: 5hg0, 2.4 Å

PDB Description: crystal structure of pantoate-beta-alanine ligase from francisella tularensis complex with sam

PDB Compounds: (A:) Pantothenate synthetase

SCOPe Domain Sequences for d5hg0a1:

Sequence; same for both SEQRES and ATOM records:

>d5hg0a1 c.26.1.0 (A:1-260) automated matches {Francisella tularensis [TaxId: 177416]}
miiadnikqfhsirnslikqqkigfvptmgalhnghislikkaksendvvivsifvnptq
fnnpndyqtypnqlqqdiqilasldvdvlfnpsekdiypdgnllriepkleianilegks
rpghfsgmltvvlkllqitkpnnlylgekdyqqvmlikqlvkdffintkiivcptqrqps
glplssrnknltstdieiankiyeilrqddfsnleeltnkinstgaklqyiqklnnrifl
afyigkvrlidnflketgps

Timeline for d5hg0a1:

• d5hg0a1 first appeared in SCOPe 2.06
  
• d5hg0a1 appears in SCOPe 2.07