Lineage for d1ewya2 (1ewy A:142-303)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 827305Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 827306Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 827307Family c.25.1.1: Reductases [52344] (4 proteins)
  6. 827318Protein Ferredoxin reductase (flavodoxin reductase) [52345] (8 species)
  7. 827321Species Cyanobacterium (Anabaena sp.), pcc 7119 [TaxId:1167] [52350] (24 PDB entries)
  8. 827344Domain d1ewya2: 1ewy A:142-303 [31541]
    Other proteins in same PDB: d1ewya1, d1ewyb1, d1ewyc_

Details for d1ewya2

PDB Entry: 1ewy (more details), 2.38 Å

PDB Description: anabaena pcc7119 ferredoxin:ferredoxin-nadp+-reductase complex
PDB Compounds: (A:) ferredoxin-nadp reductase

SCOP Domain Sequences for d1ewya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ewya2 c.25.1.1 (A:142-303) Ferredoxin reductase (flavodoxin reductase) {Cyanobacterium (Anabaena sp.), pcc 7119 [TaxId: 1167]}
lpddpeanvimlatgtgiapmrtylwrmfkdaeraanpeyqfkgfswlvfgvpttpnily
keeleeiqqkypdnfrltyaisreqknpqggrmyiqdrvaehadelwqliknqkthtyic
glrgmeegidaalsaaaakegvtwsdyqkdlkkagrwhvety

SCOP Domain Coordinates for d1ewya2:

Click to download the PDB-style file with coordinates for d1ewya2.
(The format of our PDB-style files is described here.)

Timeline for d1ewya2: