| Class b: All beta proteins [48724] (180 folds) |
| Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
| Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins) mono-domain proteins |
| Protein Azurin [49530] (6 species) |
| Species Pseudomonas aeruginosa [TaxId:287] [49533] (96 PDB entries) Uniprot P00282 |
| Domain d5i28h_: 5i28 H: [315408] automated match to d1jzga_ complexed with cu, gol |
PDB Entry: 5i28 (more details), 1.95 Å
SCOPe Domain Sequences for d5i28h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5i28h_ b.6.1.1 (H:) Azurin {Pseudomonas aeruginosa [TaxId: 287]}
aecsvdiqgndqmqfntnaitvdksckqfcvnlshpgnlpknvmghnwvlstaadmqgvv
tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
mkgtltlk
Timeline for d5i28h_: