Lineage for d5i26d_ (5i26 D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2770400Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 2770478Protein Azurin [49530] (6 species)
  7. 2770509Species Pseudomonas aeruginosa [TaxId:287] [49533] (96 PDB entries)
    Uniprot P00282
  8. 2770700Domain d5i26d_: 5i26 D: [315405]
    automated match to d1jzga_
    complexed with cu

Details for d5i26d_

PDB Entry: 5i26 (more details), 1.89 Å

PDB Description: azurin t30r1, crystal form i
PDB Compounds: (D:) Azurin

SCOPe Domain Sequences for d5i26d_:

Sequence, based on SEQRES records: (download)

>d5i26d_ b.6.1.1 (D:) Azurin {Pseudomonas aeruginosa [TaxId: 287]}
aecsvdiqgndqmqfntnaitvdksckqfcvnlshpgnlpknvmghnwvlstaadmqgvv
tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
mkgtltlk

Sequence, based on observed residues (ATOM records): (download)

>d5i26d_ b.6.1.1 (D:) Azurin {Pseudomonas aeruginosa [TaxId: 287]}
aecsvdiqgndqmqfntnaivdksckqfcvnlshpgnlpknvmghnwvlstaadmqgvvt
dgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsalm
kgtltlk

SCOPe Domain Coordinates for d5i26d_:

Click to download the PDB-style file with coordinates for d5i26d_.
(The format of our PDB-style files is described here.)

Timeline for d5i26d_: