Lineage for d5exna_ (5exn A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2387558Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2387559Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2387819Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2388211Protein Coagulation factor XI [117237] (1 species)
  7. 2388212Species Human (Homo sapiens) [TaxId:9606] [117238] (58 PDB entries)
    Uniprot P03951 388-624
  8. 2388216Domain d5exna_: 5exn A: [315403]
    automated match to d3bg8a_
    complexed with 5su, nag

Details for d5exna_

PDB Entry: 5exn (more details), 1.49 Å

PDB Description: factor xia (c500s [c122s]) in complex with the inhibitor methyl ~{n}- [4-[2-[(1~{s})-1-[[(~{e})-3-[5-chloranyl-2-(1,2,3,4-tetrazol-1-yl) phenyl]prop-2-enoyl]amino]-2-phenyl-ethyl]pyridin-4- yl]phenyl]carbamate
PDB Compounds: (A:) Coagulation factor XIa light chain

SCOPe Domain Sequences for d5exna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5exna_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]}
ivggtasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysg
ilnqseikedtsffgvqeiiihdqykmaesgydiallklettvnytdsqrpislpskgdr
nviytdcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyregg
kdackgdsggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektqa

SCOPe Domain Coordinates for d5exna_:

Click to download the PDB-style file with coordinates for d5exna_.
(The format of our PDB-style files is described here.)

Timeline for d5exna_: