SCOPe 2.06: Domain d1qufa2: 1quf A:142-303

Lineage for d1qufa2 (1quf A:142-303)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
   3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families)
   binds NADP differently than classical Rossmann-fold
   N-terminal FAD-linked domain contains (6,10) barrel

5. Family c.25.1.1: Reductases [52344] (5 proteins)

6. Protein Ferredoxin reductase (flavodoxin reductase) [52345] (9 species)

7. Species Anabaena sp., pcc 7119 [TaxId:1167] [52350] (19 PDB entries)

8. Domain d1qufa2: 1quf A:142-303 [31540]
   Other proteins in same PDB: d1qufa1
   complexed with fad, nap

Details for d1qufa2

PDB Entry: 1quf, 2.25 Å

PDB Description: x-ray structure of a complex nadp+-ferredoxin:nadp+ reductase from the cyanobacterium anabaena pcc 7119 at 2.25 angstroms

PDB Compounds: (A:) ferredoxin-nadp+ reductase

SCOPe Domain Sequences for d1qufa2:

Sequence; same for both SEQRES and ATOM records:

>d1qufa2 c.25.1.1 (A:142-303) Ferredoxin reductase (flavodoxin reductase) {Anabaena sp., pcc 7119 [TaxId: 1167]}
lpddpeanvimlatgtgiapmrtylwrmfkdaeraanpeyqfkgfswlvfgvpttpnily
keeleeiqqkypdnfrltyaisreqknpqggrmyiqdrvaehadqlwqliknekthtyic
glrgmeegidaalsaaaakegvtwsdyqkdlkkagrwhvety

Timeline for d1qufa2:

• d1qufa2 first appeared (with stable ids) in SCOP 1.55, called d1quf_2
  
• d1qufa2 appears in SCOPe 2.05
  
• d1qufa2 appears in SCOPe 2.07
  
• d1qufa2 appears in the current release, SCOPe 2.08