Lineage for d1quf_2 (1quf 142-303)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 68846Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
  4. 68847Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families) (S)
  5. 68848Family c.25.1.1: Reductases [52344] (4 proteins)
  6. 68852Protein Ferredoxin reductase (flavodoxin reductase) [52345] (8 species)
  7. 68855Species Cyanobacterium (Anabaena sp.), pcc 7119 [TaxId:1167] [52350] (8 PDB entries)
  8. 68861Domain d1quf_2: 1quf 142-303 [31540]
    Other proteins in same PDB: d1quf_1

Details for d1quf_2

PDB Entry: 1quf (more details), 2.25 Å

PDB Description: x-ray structure of a complex nadp+-ferredoxin:nadp+ reductase from the cyanobacterium anabaena pcc 7119 at 2.25 angstroms

SCOP Domain Sequences for d1quf_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1quf_2 c.25.1.1 (142-303) Ferredoxin reductase (flavodoxin reductase) {Cyanobacterium (Anabaena sp.), pcc 7119}
lpddpeanvimlatgtgiapmrtylwrmfkdaeraanpeyqfkgfswlvfgvpttpnily
keeleeiqqkypdnfrltyaisreqknpqggrmyiqdrvaehadqlwqliknekthtyic
glrgmeegidaalsaaaakegvtwsdyqkdlkkagrwhvety

SCOP Domain Coordinates for d1quf_2:

Click to download the PDB-style file with coordinates for d1quf_2.
(The format of our PDB-style files is described here.)

Timeline for d1quf_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1quf_1