Lineage for d5hhwa_ (5hhw A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2586062Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2586063Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2586210Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2588247Protein Insulin receptor [56162] (1 species)
    PTK group; InsR subfamily; membrane spanning protein tyrosine kinase
  7. 2588248Species Human (Homo sapiens) [TaxId:9606] [56163] (18 PDB entries)
  8. 2588257Domain d5hhwa_: 5hhw A: [315394]
    automated match to d1p14a_
    complexed with 60o, edo

Details for d5hhwa_

PDB Entry: 5hhw (more details), 1.79 Å

PDB Description: crystal structure of insulin receptor kinase domain in complex with cis-(r)-7-(3-(azetidin-1-ylmethyl)cyclobutyl)-5-(3-((tetrahydro-2h- pyran-2-yl)methoxy)phenyl)-7h-pyrrolo[2,3-d]pyrimidin-4-amine.
PDB Compounds: (A:) Insulin receptor

SCOPe Domain Sequences for d5hhwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hhwa_ d.144.1.7 (A:) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]}
vfpssvyvpdewevsrekitllrelgqgsfgmvyegnardiikgeaetrvavktvnesas
lrerieflneasvmkgftchhvvrllgvvskgqptlvvmelmahgdlksylrslrpeaen
npgrppptlqemiqmaaeiadgmaylnakkfvhrnlaarncmvahdftvkigdfgmtrdi
yetdyyrkggkgllpvrwmapeslkdgvfttssdmwsfgvvlweitslaeqpyqglsneq
vlkfvmdggyldqpdncpervtdlmrmcwqfnpkmrptfleivnllkddlhpsfpevsff
hseenk

SCOPe Domain Coordinates for d5hhwa_:

Click to download the PDB-style file with coordinates for d5hhwa_.
(The format of our PDB-style files is described here.)

Timeline for d5hhwa_: