Lineage for d1bjk_2 (1bjk 142-303)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily) Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families) 
Family c.25.1.1: Reductases [52344] (4 proteins) Protein Ferredoxin reductase (flavodoxin reductase) [52345] (7 species) 
Species Cyanobacterium (Anabaena sp.), pcc 7119 [TaxId:1167] [52350] (5 PDB entries) 
Domain d1bjk_2: 1bjk 142-303 [31539]
Other proteins in same PDB: d1bjk_1
Details for d1bjk_2
PDB Entry: 1bjk (more details), 2.3 Å
PDB Description: ferredoxin:nadp+ reductase mutant with arg 264 replaced by glu (r264e)
SCOP Domain Sequences for d1bjk_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bjk_2 c.25.1.1 (142-303) Ferredoxin reductase (flavodoxin reductase) {Cyanobacterium (Anabaena sp.), pcc 7119}
lpddpeanvimlatgtgiapmrtylwrmfkdaeraanpeyqfkgfswlvfgvpttpnily
keeleeiqqkypdnfrltyaisreqknpqggrmyiqdrvaehadqlwqliknqkthtyic
glegmeegidaalsaaaakegvtwsdyqkdlkkagrwhvety
SCOP Domain Coordinates for d1bjk_2:
Click to download the PDB-style file with coordinates for d1bjk_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bjk_2:
- d1bjk_2 appears in SCOP 1.57
- d1bjk_2 appears in the current release, SCOPe 2.08, called d1bjka2
View in 3D
