SCOPe 2.07: Domain d5fqdc_: 5fqd C:

Lineage for d5fqdc_ (5fqd C:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (20 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188447] (892 PDB entries)

8. Domain d5fqdc_: 5fqd C: [315388]
   automated match to d4hoka_
   complexed with lvy, zn

Details for d5fqdc_

PDB Entry: 5fqd, 2.45 Å

PDB Description: structural basis of lenalidomide induced ck1a degradation by the crl4crbn ubiquitin ligase

PDB Compounds: (C:) casein kinase I isoform alpha

SCOPe Domain Sequences for d5fqdc_:

Sequence; same for both SEQRES and ATOM records:

>d5fqdc_ d.144.1.7 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
efivggkyklvrkigsgsfgdiylainitngeevavklesqkarhpqllyesklykilqg
gvgiphirwygqekdynvlvmdllgpsledlfnfcsrrftmktvlmladqmisrieyvht
knfihrdikpdnflmgigrhcnklflidfglakkyrdnrtrqhipyredknltgtaryas
inahlgieqsrrddmeslgyvlmyfnrtslpwqglkaatkkqkyekisekkmstpvevlc
kgfpaefamylnycrglrfeeapdymylrqlfrilfrtlnhqydytfdwtmlkq

Timeline for d5fqdc_:

• d5fqdc_ first appeared in SCOPe 2.06
  
• d5fqdc_ appears in the current release, SCOPe 2.08