Lineage for d5hc7a_ (5hc7 A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156
  4. Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (2 families) (S)
    the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinase
  5. Family c.101.1.0: automated matches [191361] (1 protein)
    not a true family
  6. Protein automated matches [190431] (12 species)
    not a true protein
  7. Species Lavandula lanata [TaxId:39330] [315377] (3 PDB entries)
  8. Domain d5hc7a_: 5hc7 A: [315380]
    automated match to d2d2rb_
    complexed with dst, mg

Details for d5hc7a_

PDB Entry: 5hc7 (more details), 2.05 Å

PDB Description: crystal structure of lavandulyl diphosphate synthase from lavandula x intermedia in complex with s-thiolo-isopentenyldiphosphate
PDB Compounds: (A:) prenyltransference for protein

SCOPe Domain Sequences for d5hc7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hc7a_ c.101.1.0 (A:) automated matches {Lavandula lanata [TaxId: 39330]}
devtpnhvaiiidghrkwaksrgvtvqeghqtgvnnwkhiisrasqlgiklltiwalspq
nfnrskmevdflmriyedflrsdvkelvtsqqdiqfsaigdksrlpeylqdaisyaegls
qankgmhfilavayggrediveaarkiaakvehgilrpddideatfeqhlmtnitkfpsp
dlliraageqrlsnfflwqlpftefyftpklfpdfgeadlldalasyrcr

SCOPe Domain Coordinates for d5hc7a_ are not available.

Timeline for d5hc7a_: