![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) ![]() binds NADP differently than classical Rossmann-fold N-terminal FAD-linked domain contains (6,10) barrel |
![]() | Family c.25.1.1: Reductases [52344] (5 proteins) |
![]() | Protein Ferredoxin reductase (flavodoxin reductase) [52345] (9 species) |
![]() | Domain d1b2ra2: 1b2r A:142-303 [31538] Other proteins in same PDB: d1b2ra1 complexed with fad, so4; mutant |
PDB Entry: 1b2r (more details), 1.8 Å
SCOPe Domain Sequences for d1b2ra2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b2ra2 c.25.1.1 (A:142-303) Ferredoxin reductase (flavodoxin reductase) {Anabaena sp., pcc 7119 [TaxId: 1167]} lpddpeanvimlatgtgiapmrtylwrmfkdaeraanpeyqfkgfswlvfgvpttpnily keeleeiqqkypdnfrltyaisreqknpqggrmyiqdrvaehadqlwqliknqkthtyic glrgmeegidaalsaaaakegvtwsdyqkdlkkagrwhvaty
Timeline for d1b2ra2: